(data stored in ACNUC1104 zone)

EMBL: FN667742.PE230

FN667742.PE230       Location/Qualifiers
FT   CDS_pept        complement(209048..209368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0051"
FT                   /locus_tag="XNC1_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88323"
FT                   /db_xref="GOA:D3VH38"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88323.1"
FT                   /translation="MIYAYIRISSAEQNSARQKIAIQNSGYEIKTVFTDIASGKDTHRP
FT                   NLQQLLSTLISGDTLIVHSIDRLCRNMMDMCYLTLDLKQRGISLIFLKENICFSAHENN
FT                   PL"
     atgatttatg cttatattcg tatcagctct gctgaacaaa attctgcgcg acaaaaaatt        60
     gcgattcaaa attcaggtta tgagatcaaa acagttttta ccgatattgc cagtggcaaa       120
     gatacgcatc gacccaattt acaacaatta ttatccacac ttatatctgg ggatacgctg       180
     attgttcact caatcgatcg cttatgccgc aatatgatgg atatgtgtta tttaacgctt       240
     gatctgaaac aaagagggat ttcgctcatt tttctcaaag aaaatatttg tttttctgcg       300
     catgaaaata acccactata a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page