(data stored in ACNUC1104 zone)

EMBL: FN667742.PE239

FN667742.PE239       Location/Qualifiers
FT   CDS_pept        215140..216159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0052"
FT                   /locus_tag="XNC1_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88332"
FT                   /db_xref="GOA:D3VH47"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88332.1"
FT                   /translation="MNGNFAGGYSAPDFILARNDSELVSAMPQNMAAGYFRTDLMPEVF
FT                   YHKCAQYTAIKTLAPELVFNGRSVNTLTELPRKVVKPMVIRPAFSPQSKGSALIVGGND
FT                   RPSMDDVIQQLRHYSGPFQLHDYEEGQPLFINGILSIGTLIISDMWRCITLPIGYRDIL
FT                   TAVINLSEKALPEGLPQQLAELAIGMGMLAGPLHIELVLTADGPKIVKLTPRLASSPLP
FT                   DLCHFGGWQSQQQLWQTKSCNIQHKSLIGYVADYSFIFLQAGRVKQFFFEKEIKALSSF
FT                   SYYFMSPKIGQDVQMTIDGDTYGCTLFLRNNSLEILESEIAYLTTLNLKGAFHIESIK"
     atgaacggca attttgccgg cgggtactct gcacccgatt tcattctggc acggaatgac        60
     agtgagttag tgtcagccat gccgcaaaat atggcggcag ggtattttcg tactgatctc       120
     atgccagaag tcttttatca caaatgcgct caatatacgg ctatcaaaac gctggcgcct       180
     gagctggtct ttaatggccg gagtgtcaac acgctgactg aattacctcg aaaagttgtt       240
     aagcctatgg tgattaggcc tgcattttca cctcaatcaa aaggttctgc tttgattgtt       300
     ggaggaaatg atagacccag tatggacgac gttatccaac aattgcgtca ttattcagga       360
     ccgttccaac tgcatgatta tgaagaaggg caacccctct ttattaacgg catattatca       420
     ataggcacgc tgattatcag tgatatgtgg cgctgcatta cgttgcctat cggatatcga       480
     gatattctga cagccgttat caatctatcg gaaaaagcgc tgccggaggg attacctcaa       540
     caattggccg aattggcaat tgggatggga atgctggctg gcccattgca tatagaatta       600
     gtgttaaccg cagacgggcc aaaaattgtt aagttgacac caagattggc cagttccccc       660
     ttgcctgatc tttgccactt tggtggttgg caaagtcaac aacagctttg gcaaacgaaa       720
     tcttgcaaca tacaacataa gtcgctgata ggttacgtcg ctgattattc gtttatcttt       780
     ttacaggctg ggcgtgtgaa acaattcttc tttgaaaagg aaatcaaggc attgagcagt       840
     tttagttatt attttatgtc accgaaaata gggcaggatg tgcaaatgac tattgatggt       900
     gatacttatg gatgcacatt atttttacgt aacaattcac tggaaatatt agaaagtgaa       960
     attgcttatt taacaacatt aaatcttaag ggtgctttcc atattgagtc aattaaataa      1020
//

If you have problems or comments...

PBIL Back to PBIL home page