(data stored in ACNUC1104 zone)

EMBL: FN667742.PE245

FN667742.PE245       Location/Qualifiers
FT   CDS_pept        223088..223531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0053"
FT                   /locus_tag="XNC1_0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88338"
FT                   /db_xref="GOA:D3VH53"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88338.1"
FT                   /translation="MEKVYRWEKEEFVITTDKNMLDISTIHQFLTQSHWAKGINQEVIC
FT                   RSIEHSLTFGLFHHTRQVGFARFITDFTTFGYFCDIFILDSYQGLGLGRWLMTCCMQHP
FT                   LMSQLRRIMLVTTYASWLYEKVGYLPINKENFVWEIVNPNIYQ"
     atggaaaaag tgtaccgctg ggaaaaagaa gaatttgtca ttacgacaga caaaaacatg        60
     ctggatattt ccactattca tcaatttttg actcaatctc attgggctaa gggtatcaat       120
     caagaagtca tttgtcgttc aattgaacac agcctgacat ttggcttatt tcatcatact       180
     cgccaagtgg gttttgcccg ttttattact gatttcacga cgtttggcta tttttgtgat       240
     atttttattc ttgatagtta tcagggtcta ggacttggtc gctggttaat gacatgttgt       300
     atgcagcacc ctctgatgtc ccaattacgc cgtattatgt tggtgacaac ttatgcttcg       360
     tggttgtatg agaaggtagg ttatttgcct attaataaag aaaactttgt ttgggagatc       420
     gtaaatccta atatttatca ataa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page