(data stored in ACNUC1104 zone)

EMBL: FN667742.PE246

FN667742.PE246       Location/Qualifiers
FT   CDS_pept        complement(223626..223889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88339"
FT                   /db_xref="GOA:D3VH54"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88339.1"
FT                   /translation="MNAHNKELFQDYLRKRHSVSKLVVHLVFTTKYRRKIFTGVMIEQL
FT                   KEAFESACVKLECQLIEMDGEQDHVHLLISPPSSGEGLRRNC"
     gtgaacgcgc acaataaaga actgtttcaa gactacctca gaaaaaggca tagtgtgagc        60
     aaactagttg tacatctggt gttcacaacg aaatatcgaa gaaagatttt tacgggtgta       120
     atgattgagc agttgaaaga ggcgtttgaa tctgcttgcg taaaattgga gtgtcagctt       180
     attgaaatgg acggcgaaca agatcatgtt catttgctta tatccccgcc ctcatcgggc       240
     gagggtttac gccgaaattg ctaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page