(data stored in ACNUC1104 zone)

EMBL: FN667742.PE256

FN667742.PE256       Location/Qualifiers
FT   CDS_pept        229684..229860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88349"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88349.1"
FT                   /translation="MKALRIKDMMKPQSKSHYFTSLRLNATEPPLEPSIEFVEKRLNIP
FT                   LIAYPMRYLPDIV"
     ttgaaggcgt tgcgaattaa agacatgatg aaaccacaga gtaaaagtca ctattttacc        60
     tcacttcgcc ttaatgcgac agaaccacca cttgagccca gtatcgaatt tgtcgagaag       120
     agattgaata ttccgctgat agcttatccg atgcgttacc tgccagacat cgtttag          177
//

If you have problems or comments...

PBIL Back to PBIL home page