(data stored in ACNUC1104 zone)

EMBL: FN667742.PE276

FN667742.PE276       Location/Qualifiers
FT   CDS_pept        complement(251569..251703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88369"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88369.1"
FT                   /translation="MAVVYQTLHLKDKPTVNQCLYLIEKIKKSEMQNATQMSGILTRY"
     ttggctgtag tctatcagac tctacatttg aaagataagc ccacagttaa ccaatgttta        60
     tatcttattg aaaaaattaa aaaatcagaa atgcaaaatg ccactcagat gagtggcatt       120
     ttgactaggt attaa                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page