(data stored in ACNUC1104 zone)

EMBL: FN667742.PE285

FN667742.PE285       Location/Qualifiers
FT   CDS_pept        257450..257671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88378"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88378.1"
FT                   /translation="MIASPERNRYKEYGSQGGGGHLIMLKLCGCFWQSFLVSSKKYRSG
FT                   ANSLPKMINKYIYRFLLCKIICLLFKLN"
     atgatagctt ctccagaaag aaatcgctat aaagagtatg gctcacaggg tgggggaggc        60
     catctcatta tgctcaaatt gtgtggctgt ttttggcaat cattcttagt ttcttcaaaa       120
     aagtatcgga gtggtgctaa tagtttgcca aaaatgatca ataagtacat ttatcgattt       180
     cttctttgta agattatctg cttattgttt aaacttaatt ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page