(data stored in ACNUC1104 zone)

EMBL: FN667742.PE295

FN667742.PE295       Location/Qualifiers
FT   CDS_pept        complement(262194..262508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88388"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88388.1"
FT                   /translation="MPRPCACSLAKPMATSERRERTRCVQLEPVFDRLLAVKLEQVYRI
FT                   LVPERAYIAGSVPRVKGKIDEYCRDLCQSLFQPAKREEHDCQPDCCAARVRSRTRFQRS
FT                   "
     ttgcccaggc cttgcgcgtg ttcattggcg aagccaatgg caacgagtga acggagggag        60
     agaacacgct gtgttcagct tgagccggtg tttgatcgtc ttctggctgt caagctggaa       120
     caggtttaca gaatactggt tccggaacgg gcgtacatcg ccggcagtgt tccgcgtgta       180
     aaagggaaaa ttgatgaata ttgccgcgat ctatgccaga gtctcttcca gccagcaaaa       240
     agagaagaac acgattgcca gccagactgc tgcgctgcac gagttcgctc acgaacaagg       300
     tttcaacgtt cctga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page