(data stored in ACNUC1104 zone)

EMBL: FN667742.PE340

FN667742.PE340       Location/Qualifiers
FT   CDS_pept        285922..287010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0067"
FT                   /locus_tag="XNC1_0351"
FT                   /product="Protein smf"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88433"
FT                   /db_xref="GOA:D3VHU4"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88433.1"
FT                   /translation="MEAMEIWLRMKMVSHLSVVKAIPIIERLLQTKNCSTAFLKECGLS
FT                   LAQCLQFTNASPSMLASAFNWLEKPDNHLLTFSHPEYPPLLKQIHSPPLVLFVMGDVSV
FT                   LSQKQISMVGSRAATFYGEKWGRIFAGELAKNNLVITSGLAIGIDGFCHQSALDAGGKT
FT                   IAVLGSGLENIYPTRHQPLAQRIKENGTLVSEFFPDTSPKAKNFPRRNRIISGLSLVLV
FT                   IVEAHKNSGSLITARCALEQGRDIFALPGPLGVPSNEGNHWLIKQGAYLATNVADIMEH
FT                   INTSFQWMNIEDKGREDENKQFEQTELPFADVLVNVSNEVTPIDVIAQRSSLPVAEVMT
FT                   KLLELELMGKVAVTAGGYVLIN"
     atggaagcga tggaaatatg gttacgaatg aaaatggttt ctcatctttc agtagtaaag        60
     gcgataccta ttatagagcg tttgttgcaa acgaagaatt gtagtactgc ttttcttaaa       120
     gagtgtggtt tgtcattagc acaatgtctg caatttacga atgctagccc ttccatgttg       180
     gcctcagcct ttaattggtt agagaaacca gataatcatt tactgacttt ttctcatcca       240
     gaatatcctc ctttattaaa gcagatacat tctccgcctc ttgtgctctt tgtcatggga       300
     gatgtatcag tgttgtctca aaaacaaatt tcaatggttg gtagcagggc agcgacgttc       360
     tatggagaga aatggggaag gatatttgct ggtgagttgg ctaaaaataa tctggtgatc       420
     accagtgggc ttgcgattgg tattgatggc ttctgtcatc agtctgcatt ggatgcagga       480
     ggaaaaacta ttgctgtact tggtagcggt cttgaaaata tttatcccac tcggcaccag       540
     cctttggctc agcgtattaa agaaaatggc acattagttt ctgaattttt tcctgataca       600
     tcacccaagg ctaagaattt cccaagacgc aatcgaatta tcagtggatt gagtctggtt       660
     cttgttattg tagaggctca taagaacagt ggttcattga tcacggcacg ttgtgcgctt       720
     gagcaaggac gagatatctt tgcactacca ggcccattgg gcgttccttc gaacgaaggt       780
     aatcattggt taattaaaca aggtgcttat ttggcaacaa atgtggcaga tataatggaa       840
     catattaaca cctcatttca atggatgaat atcgaagata aaggaaggga agatgagaat       900
     aaacaatttg aacaaacaga gttgccattt gcggatgtgc tggttaacgt aagtaatgaa       960
     gtaacaccta ttgatgttat agcccagcgt tcttcgcttc ctgttgctga agtcatgacc      1020
     aaattattgg agctggaact gatgggcaaa gttgctgtta ctgctggtgg atacgtttta      1080
     attaattga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page