(data stored in ACNUC1104 zone)

EMBL: FN667742.PE344

FN667742.PE344       Location/Qualifiers
FT   CDS_pept        289019..289291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0067"
FT                   /locus_tag="XNC1_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88437"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88437.1"
FT                   /translation="MNQSIQFPDREEWDEAEKRVLFPAIVDGLLVECMISADVIIKRYG
FT                   KAYCPLELFRQHRWDLEEEFETVILSGRDDKFGRYSLPSDCSANK"
     atgaatcaat caattcaatt cccagatcgt gaagaatggg atgaagctga gaagagggtg        60
     ctgtttccag caatagtgga tggtttgcta gtggaatgta tgataagtgc tgatgtaatc       120
     attaagcgtt atggtaaggc ttattgccca ctcgagctat ttcgccaaca tcgttgggat       180
     ctggaagaag agtttgaaac ggttattttg agtgggcgtg atgataaatt tgggcgctat       240
     tctttaccct cagactgttc tgctaataaa tag                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page