(data stored in ACNUC1104 zone)

EMBL: FN667742.PE357

FN667742.PE357       Location/Qualifiers
FT   CDS_pept        306069..306404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0069"
FT                   /locus_tag="XNC1_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88450"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88450.1"
FT                   /translation="MLVLSEIKTLEALKAKGSFKKVMAEINKLIPIKARGWKHLWEKIL
FT                   ELRKYAENDDLVHAAIFFKTEDLAAIKKYLWMVIVTLRQYNLYISSMYEGINYFKYENS
FT                   ENEVRWN"
     atgttagtgc ttagtgaaat taaaacgtta gaagctttga aagctaaagg atcatttaag        60
     aaagtgatgg cagaaataaa taagctaata cctatcaagg caagaggttg gaaacattta       120
     tgggaaaaaa ttttggagtt acgtaaatat gctgagaacg atgatcttgt tcatgctgct       180
     atatttttta aaacagaaga tcttgctgcc attaaaaaat atttatggat ggttatagta       240
     actcttcgcc aatataattt gtatatcagt tcaatgtatg aagggatcaa ctattttaag       300
     tacgagaact cagagaatga agtacgatgg aactga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page