(data stored in ACNUC1104 zone)

EMBL: FN667742.PE38

FN667742.PE38        Location/Qualifiers
FT   CDS_pept        complement(40823..42280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0007"
FT                   /locus_tag="XNC1_0038"
FT                   /product="conserved hypothetical protein; putative von
FT                   Willebrand factor type A (vWA) domain"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88131"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88131.1"
FT                   /translation="MLTLTTLDLLLSINEGELIEEITLTLLSTPQLLIFFEKFPRIKQA
FT                   LQKDLPAWQQILLQRIKEAQIPAPLAEEFQLYQQVQASNTEDFYQQLPIIVEKLQQIGS
FT                   PFANEANTLLKTISGHTHSEHILFLQHWRINLIRQVTIFNKMLLEQEKEQLLAEIQKRL
FT                   TLIDHLDPVFDHNDRAAGRLWDMSKSQLHLTSQHTQLITLYADFLTHQPELEKLAQLLG
FT                   RSQTAKSIPEESHALQPITRLERIPDTVPEQVSGIRQSNDILRLLPTEIAMLGIEELEY
FT                   EFYRRLAEKKLLSYRLQGDSWQLKTTLKRVTHHHNKEQPKGPFIVCVDTSGSMGGFNEL
FT                   CAKAFCLALMRIALEDNRHCHIMLFSTALIHYELTSPTGLTQAIHFLGQTFRGGTDLAY
FT                   CLSTTVEKMKENIWKDADTVVISDFIAQRLPDTLIHQIKNLQQHQQHRFHAVSLSHYGK
FT                   PGIMRIFDHIWHFDTGFISRLQRKRRN"
     atgttaactc tgaccacact cgatctctta ctttccatca atgaaggtga gctgatcgaa        60
     gagatcacat tgaccctgtt gagtacccct caattgctta ttttctttga aaagtttccg       120
     agaattaagc aggcattgca gaaagatctc cccgcatggc agcaaatatt gttgcaaaga       180
     ataaaagagg cacagatccc agcgccattg gctgaagaat ttcagctata tcaacaagta       240
     caagcaagca atacagaaga tttttatcaa caactgccca ttattgtaga aaaacttcaa       300
     caaattgggt caccttttgc caatgaagcc aatacactgc taaaaaccat atccgggcat       360
     acgcattccg aacacatact ctttctacaa cactggcgca ttaatctgat ccggcaagta       420
     acaatattca acaagatgtt gttagaacaa gaaaaagaac agctattggc cgagatccaa       480
     aaacgcctaa ccctcatcga ccatcttgat ccagtatttg atcataatga tcgcgccgct       540
     ggtcgattgt gggacatgag caaaagccag cttcacctga cttcacaaca tacacaactc       600
     attacgcttt atgctgattt tctcacacac caacccgaac tggaaaaatt agcgcaatta       660
     ctgggccgca gccaaacggc taaatcaatt cctgaagaaa gccatgccct tcaacccatt       720
     acccgattag aaagaatacc agacactgta ccagaacaag ttagcgggat tcggcaaagc       780
     aatgatattt taagactgtt acccacagag atcgccatgc tgggtattga agagctggaa       840
     tacgaatttt atcggcggct tgcggagaaa aaattactgt cttatcgcct gcaaggagat       900
     agctggcagc taaaaacgac attaaaacga gtcacccatc atcacaataa agaacagcca       960
     aagggacctt tcattgtttg tgtcgataca tcaggttcaa tgggcggatt taatgagtta      1020
     tgtgcaaagg cattttgtct ggccttgatg cgtattgcac tggaggataa tcgccattgc      1080
     catattatgt tgttctcgac agcactgatt cactatgaac tgacatcacc aactggactc      1140
     actcaggcga tccactttct gggacagaca ttccggggag gaaccgatct tgcatactgt      1200
     ttaagtacaa cggttgaaaa aatgaaagaa aatatctgga aagatgctga tactgttgtt      1260
     atttcagatt tcattgccca gcgtttgcca gacaccctaa tccatcagat aaaaaatctg      1320
     caacagcatc aacaacaccg cttccatgcg gtctcccttt cccattatgg aaaacccggt      1380
     atcatgcgaa tattcgatca tatctggcat tttgataccg gatttataag ccgcttacag      1440
     agaaagcggc ggaattaa                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page