(data stored in ACNUC1104 zone)

EMBL: FN667742.PE383

FN667742.PE383       Location/Qualifiers
FT   CDS_pept        complement(333871..334167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88476"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88476.1"
FT                   /translation="MKGKTFNDTLKLHKEIEEKEKRKQNVLGWQENKKEKAPLFAGLSQ
FT                   NLVGERGFEPPTHWSQTSCATKLRYSPKCLSLISFLWCEGGDLNPHVRKDTNT"
     atgaaaggaa aaacattcaa tgacacattg aagcttcata aagaaatcga agagaaagaa        60
     aagagaaaac aaaacgtatt gggttggcaa gaaaacaaaa aagagaaagc cccgctattt       120
     gcggggcttt ctcagaatct ggtcggcgag agaggattcg aacctccgac ccactggtcc       180
     caaaccagtt gcgctaccaa gctgcgctac tcgccgaaat gtctttcttt aatctctttt       240
     ttatggtgcg aaggggggga cttgaacccc cacgtccgta aggacactaa cacctga          297
//

If you have problems or comments...

PBIL Back to PBIL home page