(data stored in ACNUC1104 zone)

EMBL: FN667742.PE384

FN667742.PE384       Location/Qualifiers
FT   CDS_pept        complement(334219..334455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0073"
FT                   /locus_tag="XNC1_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88477"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88477.1"
FT                   /translation="MSIYTPFNAFNVPIFSFKINSSSPRVNLISVIPISLSLESIQNTV
FT                   SHLRHSTREFKILIKNQSIKCLLFETLKGIVCR"
     atgagtatct acacgccttt taatgcattt aacgtgccaa ttttttcctt caaaataaat        60
     tcttcttccc ctcgcgttaa cttgatttcc gttattccta tttcactttc actagaaagc       120
     atccaaaaca ccgtctctca tttgcgacac tctacaagag aatttaaaat actcattaaa       180
     aatcaatcca ttaaatgtct tctatttgag actctcaaag gtatagtttg tcgctga          237
//

If you have problems or comments...

PBIL Back to PBIL home page