(data stored in ACNUC1104 zone)

EMBL: FN667742.PE402

FN667742.PE402       Location/Qualifiers
FT   CDS_pept        349750..350175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0077"
FT                   /locus_tag="XNC1_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88495"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88495.1"
FT                   /translation="MKTVYMLDTNICSFIMREQPVAVIKQLQRCVMNNHLIVVSAITYA
FT                   EMRFGAVGKKASPKHIVLVDEFCRRLDKILPWDKSAVDATTKTKIALAAAGTPIGHNDA
FT                   AIAGHALSVGATLITNNSREFSRVTGLSLEDWANGLI"
     atgaaaacag tttacatgct ggataccaat atttgttcat tcattatgcg tgaacaacct        60
     gttgcagtaa ttaaacaatt acagagatgc gtgatgaata accatctgat cgttgtatct       120
     gcgattactt atgcggaaat gcgcttcggg gcagttggaa agaaagcttc cccgaaacat       180
     attgtattag ttgatgagtt ttgtagacga ttagataaaa ttttaccttg ggataaatcc       240
     gcggtagacg caacaactaa aacaaagatt gcattagctg ctgctggaac gcctattgga       300
     cataatgatg ctgctattgc agggcatgct ttgtctgtag gagcgacatt gataacaaac       360
     aatagtcgtg aattttctcg tgtcactgga ctatcattag aagattgggc taacgggctg       420
     atttaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page