(data stored in ACNUC1104 zone)

EMBL: FN667742.PE404

FN667742.PE404       Location/Qualifiers
FT   CDS_pept        complement(351695..352180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88497"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88497.1"
FT                   /translation="MENMLQADKILTLEEAQQFLNEIFIYQMPFNQLLGLELLRFEQDY
FT                   AELQFRKQEKLIGNIAQKILHGGAIASILDVAGGLICAHRALVTLEMLTIPEMQKRLST
FT                   LGTIDLRVDYLRPGRGEVFTASSNIIRAGNKVSVARIELHNEQQVHIASATGTYLVG"
     atggaaaata tgctacaagc agacaaaata ttaacactag aagaagccca acaattcctc        60
     aacgaaatat ttatttatca gatgccattt aaccagcttc tgggacttga actgctccga       120
     ttcgaacaag actacgcaga gctgcaattt cgcaagcagg aaaagctgat cggtaatata       180
     gcccagaaga tcctgcatgg tggtgcgatc gcttccatac tggatgttgc aggaggtttg       240
     atctgtgcac atcgtgctct ggtaacgctg gaaatgctca caatccctga aatgcaaaaa       300
     cgcttgtcaa cattgggcac tattgattta cgtgtggatt acctgcggcc cggacgtggt       360
     gaagtgttta ctgcaagcag caatattatc cgggccggca acaaagtatc agtcgcccga       420
     attgaactgc acaatgaaca gcaggtacat attgccagtg cgacaggaac ttatttggtt       480
     ggttaa                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page