(data stored in ACNUC1104 zone)

EMBL: FN667742.PE414

FN667742.PE414       Location/Qualifiers
FT   CDS_pept        complement(360977..361156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88507"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88507.1"
FT                   /translation="MHTHKQMTPGLVQFDNVSYIDKEKINFGAIRQGKIEMFKRFLAAK
FT                   KTAERKGKIMVKPL"
     atgcatacgc ataaacagat gactccagga ctggttcaat ttgataatgt tagctatatt        60
     gataaagaaa aaattaattt cggtgctatc cgtcagggca agattgaaat gtttaaacgt       120
     tttcttgctg cgaaaaaaac cgcagagcgg aaaggcaaaa tcatggtcaa gccactctaa       180
//

If you have problems or comments...

PBIL Back to PBIL home page