(data stored in ACNUC1104 zone)

EMBL: FN667742.PE415

FN667742.PE415       Location/Qualifiers
FT   CDS_pept        complement(361276..362481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0080"
FT                   /locus_tag="XNC1_0431"
FT                   /product="hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88508"
FT                   /db_xref="GOA:D3VI19"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88508.1"
FT                   /translation="MTRRIPFQVSGLLALNGVSILGNAITEIAIPWLILEISGSPLLVA
FT                   TVMSAKILPLILSIFFSAQWVDKYGAFRISLLSDAVNFLSVLLIPVFYTMDILHFYLLA
FT                   VLLIFSTILDSSGRLAKDVMLAKEIKRNKSEHELINGINSTIENICDLIGPVIGSLIIA
FT                   LLGTINALYFDAISFLIVTLGIIILKKHFVANINEVVETPFRPRHYFLEALRYIRSEKE
FT                   LFSVLMISSIVNFVLSPFLIVYLPYVNKQEFNSILSLGISMTCFGVGTTFSSLLYGAYG
FT                   KYFSSHRIILSGYSLLALFLLSLNLFSGQYALYAQLFAIGLCIGFSAPVEITLIQRQVP
FT                   ENLFGRIMTFFSSTRFLSVPVGYLCFGALLESRLAGLTPLIMAAVVLGGLASYWFVQRT
FT                   SK"
     atgaccagac gcataccttt tcaagtaagt ggtttactgg cattaaatgg cgtttccatc        60
     ttaggaaacg ccattaccga aattgcgatt ccgtggttga ttctcgaaat atcagggagc       120
     ccacttctcg tcgcaaccgt catgtcagcc aagatcctgc cgttaatcct ctccattttc       180
     tttagcgcac aatgggttga taaatacggt gcctttcgca tttcactgtt atctgatgca       240
     gtcaatttcc tgagtgtcct gctgatacct gtattttata ctatggatat tctgcacttt       300
     tacctgctgg cggttttact catcttttcc actattctgg attcttcggg acgtctggca       360
     aaagatgtca tgctggctaa agagatcaaa cggaataaaa gcgaacatga gttgatcaat       420
     ggtatcaata gcacgattga gaatatttgc gacttgattg gccccgtcat tggttcattg       480
     attattgccc tgcttggtac gatcaacgcc ctgtattttg atgcaataag ctttttaatt       540
     gttactttgg ggatcattat tctgaaaaag cattttgtcg ccaatatcaa tgaagtggtt       600
     gaaacacctt tccgcccacg ccactatttt cttgaggctc tcagatacat aagatccgaa       660
     aaagaactat tctcagtatt gatgataagc tcaattgtga attttgttct ttcacccttc       720
     ttaattgttt atttaccgta tgtgaataaa caagaattca attccattct gagtctcggt       780
     atttcaatga cctgctttgg cgtggggaca acgttttctt cattattata tggtgcttat       840
     ggcaagtatt tttccagcca ccgcatcatc ctttctggct acagcttgct cgcactattc       900
     ctgctatctc tgaacttatt cagcgggcaa tatgccttat atgctcagct tttcgcgatt       960
     ggcctttgta ttggcttttc tgctcccgtt gaaatcacac tgattcaacg tcaggtaccc      1020
     gaaaatttat ttggccgtat catgaccttc ttttcctcta ctaggttcct ttctgtacct      1080
     gttggctatc tctgttttgg tgcactactg gaatccagac tggccgggct gacaccattg      1140
     atcatggctg ctgtggtatt aggtggattg gcgagttatt ggtttgtcca aaggacatct      1200
     aaataa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page