(data stored in ACNUC1104 zone)

EMBL: FN667742.PE468

FN667742.PE468       Location/Qualifiers
FT   CDS_pept        420389..420736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0090"
FT                   /locus_tag="XNC1_0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88561"
FT                   /db_xref="GOA:D3VIL1"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88561.1"
FT                   /translation="MKKEWYTAMELTGVGELPRSPQGVNARAKREEWLRQKRTGVQGRA
FT                   IEYHYSCFPESTLTVLELNETSPEYQVQKQDPLSIWVSAFNLLTEEEKEVITEVILRDG
FT                   IRSFLEKITAT"
     atgaaaaaag agtggtatac ggcaatggag ttgaccggtg taggcgagtt acctagatca        60
     ccacaaggag ttaatgccag agcaaaacgt gaagaatggt tgagacaaaa acgaaccgga       120
     gttcaaggca gggcaattga ataccactat tcttgttttc ctgaatccac tctgactgtg       180
     ctggaactca atgagacatc accagaatat caggttcaga aacaagatcc tttatccatt       240
     tgggtaagtg catttaattt actcactgaa gaagaaaagg aggtaattac tgaagtgata       300
     ttaagagatg gcataagaag ttttttggaa aaaattactg ctacctga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page