(data stored in ACNUC1104 zone)

EMBL: FN667742.PE495

FN667742.PE495       Location/Qualifiers
FT   CDS_pept        complement(448118..451159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0514"
FT                   /product="putative invasin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88588"
FT                   /db_xref="GOA:D3VIN8"
FT                   /db_xref="InterPro:IPR003535"
FT                   /db_xref="InterPro:IPR008541"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015217"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88588.1"
FT                   /translation="MNKKFDKSRLHNQQGLLKRVAWVNIVTQLMFPLVGAFTPALTTAE
FT                   THTSQNEKWAIPTEPYILQSGETINTVAKRYGLTVNGLKKINQLRTFDKPFTALGTGSE
FT                   IDVPKPRENKFLPFNYSALTHSTLSHSTLSNSEPDNTPATDETSRRFAEASSQASHFLA
FT                   QPSHIGKNAVSQLSHLAMREANRQIQDWLGRYGTARVQANIDSRGRLNGSQLDMLLPLH
FT                   DTKSQMIFTQFGLRRIDKRNTINLGVGQRQFFDGWMLGYNAFLDHDFTGENTRFGLGAE
FT                   YARDYLKLGVNSYFRLSHWKESRLLTDYDERPANGFDLRAQGYVPSLPQLGGKLVYEHY
FT                   FGDEVGLINKDHRSTNPSAFTAGINYTPIPLLTFVIDRRQDASGNGETQFNMELNYEIG
FT                   TPWAQQIDPGAVTFKRTLQGSRYDLVDRNNQIVLEYRKREVISLAMDNSIVGNAGDIKP
FT                   IHISIKSKYGLKEIKWDAPGLFANGGTIKSQGGTHYLLTLPKYQIQGNNTYTVGAIAYD
FT                   EKGNASNRAEMQLHVLRAEANANQSTFTAKDKELAADGHSKTLLILALKNKQGDPISGI
FT                   APDIKLGASGLSGKGRDPQIETMQETQPGIYQSLLTAGEKTGVLKITPQVDGITIKPVE
FT                   ILFVHPEAPLIKNLTIFGKLAMGQTLRATYTFNSNHGDATDKSRYVWGDKGSTDISKGH
FT                   AITESGKIPDYPLTLSDAGTVKELAVQARNALGIIGNTNIVDTSMSAEQGNHTYDSGKG
FT                   GTVRGLADSMTTTISTGKVKKGESITLTIKTLNHGKAVRNVAVRVNAIKALNRQNVSES
FT                   PTVLLNGQSGIYQDFTDKQGMLSVVITDPNGLGVKTTLSVTADRTAAPQTQDVIFTVVT
FT                   SPDVDVANFWGHMDEAAVAENGIVFTRPKLQAEVTRMHFKAMDTHTEAGEVWPKRIHFG
FT                   AELYCKGIHGTLPTKEELMGLYNAHPNNAMHDIYGWPQQRAYRSSTPHIEKNSRKNEHY
FT                   SVNIDLGVLHIVGKTTTEYTICKQ"
     atgaacaaaa aattcgataa gtcgcggcta cataatcagc agggcctgct gaaacgtgta        60
     gcttgggtaa atattgtcac tcaacttatg tttccacttg ttggtgcatt cactcccgcg       120
     ctgacgactg ccgaaacaca cacctcccaa aatgagaaat gggcaatacc aacagagcct       180
     tatatcctgc aatcaggaga aaccatcaat accgttgcca aacgctatgg tttaaccgtc       240
     aatggcctga aaaaaatcaa tcaactgcgt actttcgata aaccttttac cgcacttggc       300
     acaggtagcg aaattgatgt cccaaagccc cgtgaaaata aatttcttcc ttttaattat       360
     tctgccctaa cccattctac cctaagtcat tctaccctaa gtaattccga gccagacaac       420
     acaccagcta cagatgaaac atctcgtcgc ttcgctgaag cctcgtctca ggccagtcac       480
     tttttagccc agccaagcca tattggaaaa aacgcggtca gccaattaag ccatttggcg       540
     atgagagaag ccaatcgaca aattcaagat tggctgggac gctacggcac ggcgcgtgtg       600
     caagccaata tagacagccg tggtcgtttg aatggcagcc agctcgatat gcttttgcct       660
     ttgcacgata ccaagagcca aatgattttt actcagtttg gcctgcgccg tattgataaa       720
     cgcaatacca tcaatctcgg cgtcgggcaa cgtcagtttt ttgatggctg gatgctgggt       780
     tacaatgctt ttcttgacca tgatttcacc ggtgagaata cccggtttgg ccttggcgca       840
     gaatatgccc gtgattatct gaaattaggc gtaaacagct acttccgttt aagtcactgg       900
     aaagaatccc gccttttgac agattatgat gagcgaccgg ccaacggttt cgatctgaga       960
     gctcagggtt acgtcccttc tttgccacaa cttggcggaa agttagtcta tgaacactat      1020
     ttcggagatg aagtcggatt aatcaataaa gatcaccggt caacaaaccc ttccgctttt      1080
     acggcgggaa tcaattatac cccgatccca ttactgactt tcgtaattga ccgcagacaa      1140
     gacgcatccg gtaacggaga aacacagttc aatatggaac tgaattatga aatcggtact      1200
     ccgtgggcac aacaaattga tccgggtgca gtgacattca aacgtactct gcaaggcagc      1260
     cgctatgatt tagtcgatcg taataatcag atagtcttag agtaccgtaa acgggaagtg      1320
     atctctctgg caatggataa ttcaattgtc ggcaatgcgg gagatatcaa acccatccat      1380
     atcagcatca agagcaaata tgggcttaaa gagatcaaat gggatgcccc ggggctgttt      1440
     gccaatggcg gcacaattaa atctcagggt ggaacacact acttactgac cttgcccaaa      1500
     tatcaaattc agggcaacaa tacctacacc gtgggcgcta ttgcttatga tgaaaaggga      1560
     aacgcttcca atcgggctga aatgcagcta cacgtgctgc gggcagaagc caatgccaat      1620
     caatccactt tcacagcaaa agataaagaa ctggcggctg acggacattc caaaactctc      1680
     ctcattttgg cactgaaaaa taaacagggc gatcccatca gtggaatcgc cccagatatc      1740
     aaattgggcg ccagtggatt aagcggaaaa ggccgcgatc cacagatcga aacaatgcaa      1800
     gaaacccaac cgggcatcta tcaatccctg cttactgccg gcgaaaagac cggggtactg      1860
     aaaattacgc cacaagtaga cgggattacc attaaaccgg ttgagatcct gttcgtacat      1920
     cctgaagctc cactcatcaa aaatctgact atctttggca aattagccat ggggcaaaca      1980
     ttaagagcaa cctatacctt taattccaat cacggtgatg caaccgataa atcccgttat      2040
     gtctgggggg acaaaggcag cactgatatt tcaaaaggcc atgcaatcac tgaatcaggc      2100
     aaaatccctg actatccatt gacactatca gatgctggta cggtaaaaga acttgcagtg      2160
     caagcccgga atgcacttgg cattattggg aatactaata tcgttgatac cagcatgagt      2220
     gccgagcaag gcaaccatac ttatgatagc ggcaaaggtg gcacggtcag aggactggcc      2280
     gatagtatga caacaacgat aagtaccggt aaggtcaaaa aaggcgaatc aatcacgctg      2340
     acgatcaaga cgctgaatca tgggaaagcg gtcaggaatg tggcggtcag agttaacgct      2400
     atcaaggcat taaaccgaca aaatgtttct gaatccccca ccgtattgct caacggtcag      2460
     tccggtatat accaagattt caccgataag caaggtatgt tgtctgttgt catcaccgac      2520
     ccgaatgggc ttggtgtgaa gacaacactg tctgtcactg cggacagaac ggcggcacct      2580
     caaacacaag atgttatttt cacggttgta accagcccgg atgtcgatgt cgcaaatttc      2640
     tggggacaca tggatgaagc cgcggtggca gaaaatggca ttgtctttac tcgccctaaa      2700
     ttacaagcag aagtcacgag aatgcacttt aaagcaatgg atactcatac tgaagcgggt      2760
     gaagtttggc ctaaacgcat ccactttggt gccgaattgt actgcaaagg catacatggc      2820
     acattaccaa ccaaagaaga gttaatgggt ttgtacaacg cacatccaaa caacgcaatg      2880
     catgatatat acgggtggcc acaacaacgt gcttatcgtt cttctacccc acacatagaa      2940
     aagaactcca ggaaaaatga acattattca gtaaacatcg atctgggagt gctgcatatt      3000
     gtcgggaaaa ccaccacaga gtataccatc tgcaagcaat aa                         3042
//

If you have problems or comments...

PBIL Back to PBIL home page