(data stored in ACNUC1104 zone)

EMBL: FN667742.PE496

FN667742.PE496       Location/Qualifiers
FT   CDS_pept        452552..452809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0097"
FT                   /locus_tag="XNC1_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88589"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88589.1"
FT                   /translation="MGDLLSILDVESGNAAGSWLTLFFQRRLRIEGNTELGLHVKNLLD
FT                   STELESMPSILRFGLLRLAEFIKAGQKEGVDQHDRALSPC"
     atgggagatt tattatcgat tcttgatgta gaatcgggaa atgcagcggg atcttggctt        60
     acactgtttt ttcagcgtcg tttacggatt gaaggaaaca cagaattggg actgcatgtg       120
     aaaaatctgt tggattccac tgagttggaa tctatgccat ccattcttcg ctttggttta       180
     ttgcgtctgg ctgaatttat caaagcggga cagaaagagg gcgttgatca acacgatcgc       240
     gcgttatcgc catgttaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page