(data stored in ACNUC1104 zone)

EMBL: FN667742.PE499

FN667742.PE499       Location/Qualifiers
FT   CDS_pept        453933..454184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0518"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88592"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88592.1"
FT                   /translation="MKVVKNIMAILTLSAISFGSFAATEVKDAKSDKIGVVSVTGASTL
FT                   DSLTEELSKKADKAGATYFRVVFANGQNQLNGVAEIYK"
     atgaaagttg taaaaaatat catggctatt ttgacattaa gtgctatttc atttggttca        60
     tttgctgcta ctgaagtgaa agatgctaaa tcggataaaa ttggtgttgt ttcagtaacg       120
     ggtgcatcta ccctggatag tttaaccgaa gagttatcca aaaaagctga caaagctggc       180
     gcaacttatt tccgcgttgt ttttgccaat ggtcagaatc aactcaatgg agttgctgaa       240
     atctataaat aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page