(data stored in ACNUC1104 zone)

EMBL: FN667742.PE5

FN667742.PE5         Location/Qualifiers
FT   CDS_pept        complement(6274..6897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0005"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88098"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88098.1"
FT                   /translation="MKLNKSHFFLIPVLLGVSHFSIADKAIEDVITKNGLKDTKVMSLY
FT                   KNGTLSVEANTPNKVTLINKKAAKDNKEANQAMYWYRGMGLNEYKKFDANKYRKVPCVT
FT                   EKNNFCGIAPEFNYSKGYLSNNNPGVVIEFSTIEPKWLYHDFTELHKCQIKAEGGGTYG
FT                   LGPTGTSASCDASYKQKGLGNVFNKWLEKPEKIDVIISYVLLTK"
     atgaaattga ataaaagcca cttctttctg atccctgttt tgctgggggt tagccatttt        60
     agtatagcgg ataaagcaat cgaagatgtc atcacaaaga atggcttaaa agatacgaaa       120
     gtgatgtcat tgtataagaa cggaacattg agcgttgaag ccaatactcc taataaggtg       180
     acattgataa ataaaaaagc cgctaaagac aacaaagagg caaaccaagc gatgtactgg       240
     tatcgaggca tgggattaaa cgaatataag aaatttgatg ccaataaata ccggaaagtt       300
     ccttgtgtca cagagaaaaa caacttttgt ggtattgcac ctgaatttaa ttactcaaaa       360
     ggttatttga gcaataataa tccaggtgtc gttattgaat tcagtaccat agaacctaaa       420
     tggttgtatc atgattttac tgagttgcat aaatgccaga ttaaggctga gggtggtgga       480
     acgtatggtt tgggacctac cggaacgtct gcaagctgtg atgccagcta taaacaaaaa       540
     gggctaggta acgtgttcaa taaatggttg gaaaaacctg agaagattga tgttattatt       600
     tcatacgtgt tattgacgaa ataa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page