(data stored in ACNUC1104 zone)

EMBL: FN667742.PE506

FN667742.PE506       Location/Qualifiers
FT   CDS_pept        458711..459136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0100"
FT                   /locus_tag="XNC1_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88599"
FT                   /db_xref="GOA:D3VIP9"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88599.1"
FT                   /translation="MEKITVDRGFDWPTMNKIPIDECYEPLEKIIDTDKLKQKPVYVTL
FT                   FDIASGQALWLGTAFDEVSELSYTAALEKSPDENMPATLYRRLLYQAMTQVGFSNLPTE
FT                   WWHYDYGNSLWAFYKNKTAIYGATAGVIPPKYRSVHK"
     gtggaaaaaa taacagtaga cagaggcttt gattggccga caatgaataa aattcctatt        60
     gatgaatgtt atgaaccttt agagaaaatt attgatacag ataaattaaa acagaaaccg       120
     gtttacgtaa cactttttga tatcgcatct ggtcaggcac tgtggttggg gacagcgttt       180
     gatgaagtca gtgaactttc ttacaccgca gcattggaaa aatccccgga cgaaaatatg       240
     ccagcaacct tataccgccg attactttat caggccatga cccaagttgg gttcagtaat       300
     ttaccgactg aatggtggca ttatgattac ggtaattcct tgtgggcatt ttataaaaat       360
     aagacggcta tttatggtgc gacagccggg gtaatccccc ctaaataccg gagtgttcat       420
     aagtag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page