(data stored in ACNUC1104 zone)

EMBL: FN667742.PE507

FN667742.PE507       Location/Qualifiers
FT   CDS_pept        459182..459448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0100"
FT                   /locus_tag="XNC1_0526"
FT                   /product="Low calcium response locus protein S"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88600"
FT                   /db_xref="GOA:D3VD11"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3VD11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88600.1"
FT                   /translation="MKKSRFTDSQILTILKQAEAGAPVPELCREHGISSARFYKWRAKY
FT                   GGMDASLMTRLKEREEENRRLKKMYAEERLKAEIIQEAMIKKW"
     atgaaaaagt cacgttttac tgacagccaa atcttaacca ttctgaaaca ggctgaagcg        60
     ggtgctcccg tgccagaact gtgtcgtgaa cacggcatca gcagtgcccg cttttacaaa       120
     tggcgagcca aatatggagg aatggacgcc tctctaatga ctcgcttgaa agaacgggaa       180
     gaagagaacc gacgccttaa aaaaatgtat gctgaagagc gactaaaagc cgagattatt       240
     caggaagcca tgataaaaaa gtggtaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page