(data stored in ACNUC1104 zone)

EMBL: FN667742.PE509

FN667742.PE509       Location/Qualifiers
FT   CDS_pept        complement(460279..460662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88602"
FT                   /db_xref="GOA:D3VIQ2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88602.1"
FT                   /translation="MQESNNKKTTEADILLSNIAQDIDFIMKKRNIDSQTLSKLTGLGI
FT                   ATINSLKRGVGNPTISTISSIADIFGVNIGEITDSKLSELTESEEIISSVPLVRYDELD
FT                   GYISGEIANINLYKLSIQDDHGG"
     atgcaagaat cgaacaataa aaaaacaacc gaagccgaca tcttgttgtc caatatcgca        60
     caagatattg attttataat gaaaaaaaga aatatagatt cacaaacact cagcaagttg       120
     acaggtttag ggattgcaac tatcaatagc ctcaagcgtg gtgttgggaa cccaactatt       180
     tctactattt catctattgc agacatattt ggtgtaaata ttggtgaaat tacagatagt       240
     aaattatctg agttaacgga gagtgaagaa attatttcat cagtacctct agttcgttat       300
     gatgaactag atggttatat atctggagaa atagccaaca taaatctata taaacttagt       360
     atccaagatg atcatggagg ttaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page