(data stored in ACNUC1104 zone)

EMBL: FN667742.PE511

FN667742.PE511       Location/Qualifiers
FT   CDS_pept        463944..464216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0101"
FT                   /locus_tag="XNC1_0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88604"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88604.1"
FT                   /translation="MAITRLRQQGGAVVVTIPSDVATVMGWSVGMQLDIKSSGDTISIK
FT                   PVERIARGRKSLSELLQSIDETEVRAFNEATAGDLNSPPVGNEVI"
     atggcaataa cacgtttacg tcaacaggga ggtgctgtag tggtcacaat ccctagtgat        60
     gttgcaacag taatgggatg gtctgtaggt atgcaattgg atataaaatc gtcaggagac       120
     acgataagca tcaaaccagt ggagagaatt gccagaggca ggaaatcgct ttctgagctg       180
     ttacagagca ttgatgaaac agaagtacgg gctttcaacg aagcgactgc cggcgactta       240
     aattctcccc ctgttggtaa tgaggtgatt tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page