(data stored in ACNUC1104 zone)

EMBL: FN667742.PE513

FN667742.PE513       Location/Qualifiers
FT   CDS_pept        464216..464590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0101"
FT                   /locus_tag="XNC1_0532"
FT                   /product="putative plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88606"
FT                   /db_xref="GOA:D3VIQ6"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88606.1"
FT                   /translation="MVSRRNVPGKGEIWHTNGNPVSGREFKGADYYLVISEFALNQKLG
FT                   TALCVPITSGGGPARSEAITVYLDGSSTDAGKITGIALCYQIRSLDLNERKATYAAQAE
FT                   PDIVDEILAKVIDILDPQLN"
     atggtgagta gaaggaacgt cccaggcaag ggtgaaatct ggcacactaa cggcaatcct        60
     gttagcggca gagagttcaa aggggccgat tattatctgg ttatctctga atttgcactg       120
     aatcaaaagc taggtactgc actttgtgtt cccattacca gtggtggagg accagcacgt       180
     tcagaagcta tcaccgtata tctggatggc tcaagcactg atgccggaaa aattactggt       240
     attgcacttt gctatcagat tcgctcactt gatttgaatg aacgcaaagc tacctatgcg       300
     gcacaagctg agcctgatat tgttgatgaa atcttagcta aagtaatcga tattttggat       360
     cctcaattaa attaa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page