(data stored in ACNUC1104 zone)

EMBL: FN667742.PE515

FN667742.PE515       Location/Qualifiers
FT   CDS_pept        465042..465203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88608"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88608.1"
FT                   /translation="MMNILVNLEQAKNKKYRRVYPGRERERFLSLNCMLYNHISSKNNS
FT                   EWSYQGIY"
     atgatgaaca tccttgttaa tctggagcag gctaagaata aaaaatatcg gagagtgtat        60
     ccagggcgag agcgtgaacg ttttttaagc ttgaattgta tgttatacaa tcacatatcg       120
     agcaaaaata actcagaatg gtcttatcaa ggcatttatt ag                          162
//

If you have problems or comments...

PBIL Back to PBIL home page