(data stored in ACNUC1104 zone)

EMBL: FN667742.PE524

FN667742.PE524       Location/Qualifiers
FT   CDS_pept        469591..469908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0103"
FT                   /locus_tag="XNC1_0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88617"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88617.1"
FT                   /translation="MSYTVIFSPEAETQIIELYDYIAAEASSNIAIRYTESIVNYCENL
FT                   STFPHRGIMRDDIRPGLRITNYKKRVVIAFIVNSERVSILGVFYGGQDFKTRLQSDDDN
FT                   H"
     atgagttata ccgtcatatt ttcacctgag gccgaaacac aaataatcga actgtacgac        60
     tacattgctg ctgaagcctc atcaaatata gctatacgat acaccgaatc tatcgtgaac       120
     tattgtgaga atttatcgac gttcccccac aggggtatta tgagggacga tatccgtcct       180
     ggtttacgaa ttaccaatta caaaaaacga gttgttatcg catttatcgt taactcagaa       240
     cgggtatcta ttctgggggt gttctatggt gggcaggatt ttaaaacacg gctacagagt       300
     gatgatgata accattaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page