(data stored in ACNUC1104 zone)

EMBL: FN667742.PE550

FN667742.PE550       Location/Qualifiers
FT   CDS_pept        complement(489240..489539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0569"
FT                   /product="Cro-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88643"
FT                   /db_xref="GOA:D3VIU3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88643.1"
FT                   /translation="MATLKELMAKRSPESQAKIEEKAAEMLLETQLYQIREALALSQTQ
FT                   VAKNLGIAQSSVAAIEQRGNELKISTLKKYIEAMGGEMTLGVKLPDGKLMNFSI"
     atggctactt taaaagaact gatggcaaaa cgtagcccag aaagtcaagc caaaatagaa        60
     gaaaaagcag ccgaaatgtt gcttgaaacg caactatacc aaattcgtga agcattagcc       120
     ctttcacaaa ctcaggtagc aaaaaacctg ggtatagccc aatcatcagt tgcagctatt       180
     gaacaacgag gaaatgaatt gaaaatttcc acactgaaaa aatacattga agcgatgggc       240
     ggcgaaatga ctttgggagt caaattacct gatggaaaat taatgaattt ctccatttaa       300
//

If you have problems or comments...

PBIL Back to PBIL home page