(data stored in ACNUC1104 zone)

EMBL: FN667742.PE554

FN667742.PE554       Location/Qualifiers
FT   CDS_pept        492121..492273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88647"
FT                   /db_xref="UniProtKB/TrEMBL:D3VIU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88647.1"
FT                   /translation="MIWQEKDNVIYNKVLAYTRRLSSCRFVGCILKSIGYRTLRQVGYI
FT                   GKSRR"
     atgatatggc aagaaaagga taacgttata tacaataaag ttctagctta tacccgtcgt        60
     ctttcaagtt gtcgctttgt tggctgcatc ttgaaatcca ttgggtatcg aactttaagg       120
     caagttggtt atataggaaa aagcagacgc tga                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page