(data stored in ACNUC1104 zone)

EMBL: FN667742.PE568

FN667742.PE568       Location/Qualifiers
FT   CDS_pept        complement(502831..503079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88661"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88661.1"
FT                   /translation="MIYVEKVRQKPRKISRFLLGDLCRKNSYTLKCFLVGVPSVHPLSR
FT                   RWTQAETVYSGSAEPDRANTREGNKSNYSAVSTHTPR"
     gtgatttatg ttgaaaaagt caggcaaaag ccccgaaaaa tctcccgatt tttattggga        60
     gatttatgca ggaaaaatag ttatactctg aagtgttttc ttgtcggagt gcctagcgtt       120
     caccctctat ctcgtcggtg gacacaggct gagaccgttt attcgggatc cgcagaacct       180
     gatcgggcta atacccgcga agggaacaag agtaattact ccgctgtcag tacacataca       240
     cctaggtaa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page