(data stored in ACNUC1104 zone)

EMBL: FN667742.PE577

FN667742.PE577       Location/Qualifiers
FT   CDS_pept        complement(509601..509816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0112"
FT                   /locus_tag="XNC1_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88670"
FT                   /db_xref="GOA:D3VJB4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88670.1"
FT                   /translation="MHNTTRDSRVCDRIKAGLLAHEGWTAQRIARALRIHDSTVSRHLK
FT                   DFLAQEKLPRKMAALKAISLPNAPLT"
     atgcacaata caacgcgtga cagtcgggtc tgtgaccgca tcaaggccgg gcttctggct        60
     catgaaggct ggacagctca gaggattgcc cgcgccttgc gtattcatga cagtacggtc       120
     agccgtcacc taaaagattt cctcgctcag gaaaaactcc cccggaaaat ggcggctctg       180
     aaagccatct ctctgccgaa cgccccgctg acctga                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page