(data stored in ACNUC1104 zone)

EMBL: FN667742.PE58

FN667742.PE58        Location/Qualifiers
FT   CDS_pept        66067..66204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88151"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88151.1"
FT                   /translation="MFDLLTQLGNPCMLNYSQRQIHKQVRPRKMVDDLIKKAQSLLPTN
FT                   "
     atgttcgatc tgctcactca attaggtaat ccttgtatgc taaattactc tcagcgtcaa        60
     atccataaac aggtcagacc aagaaaaatg gtagacgatc tgataaaaaa agcacaatcg       120
     cttttaccaa ctaactga                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page