(data stored in ACNUC1104 zone)

EMBL: FN667742.PE587

FN667742.PE587       Location/Qualifiers
FT   CDS_pept        516798..517694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0113"
FT                   /locus_tag="XNC1_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88680"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88680.1"
FT                   /translation="MTIALIDHCYSILPEGKKQQAISLLNRSGFLVSTDCIQHDGGKES
FT                   IFIHFTGSYLELIEVVNLNQFESSCNATELRASKFGYPYAMVAATGNIKNCENKLKKFY
FT                   QNVTNIRYVVPNMTGWEKAAWAILDISELHTPGCYFQFIQYLLRKPSWAEINHGLNNIY
FT                   GICGFYFCTNTPFEDREYWYDFLSLMEDCSKLEKNSLSIGMQQLYWLYPDEFYDYFGVQ
FT                   LSLEESQGARLGAVKLLSSDIELSFNYLKGGGFVIEGCTGQDFYTKVDPNLGYALHIVK
FT                   GNGAFDYAMDINRRLLE"
     gtgacaattg ctttaattga tcactgttat agtattcttc cggaaggaaa gaaacaacaa        60
     gccatttctt tgttaaatcg ctccggtttc ctggtcagta ctgactgtat acagcatgat       120
     ggaggaaaag agagtatttt tattcatttc acaggatctt atctggaatt gattgaagtt       180
     gttaatctga atcaatttga atcctcttgt aatgcgactg aattgcgggc atcaaagttt       240
     ggttacccat atgcaatggt tgctgcaaca ggaaatatta aaaattgtga aaataaactg       300
     aaaaaatttt atcagaatgt tactaatatc aggtatgtcg ttcctaatat gacgggttgg       360
     gaaaaagcgg catgggccat tttagatatt tctgagcttc acaccccagg gtgttatttt       420
     cagtttatac aatacctttt gagaaagcct tcatgggccg aaataaatca tgggctaaat       480
     aacatttatg gaatctgtgg tttttatttc tgtacaaata cgccatttga agatagagaa       540
     tattggtatg attttctttc tttgatggaa gattgttcca aattggaaaa aaattcatta       600
     tctataggta tgcagcagtt atattggttg tatcctgatg aattttatga ttattttggt       660
     gttcaactta gtttggaaga gagtcaggga gctagattag gtgctgtaaa acttttatct       720
     tctgatatag aactatcatt taactattta aaaggtggag gatttgttat agaaggctgt       780
     accggacagg atttttatac aaaagttgat cctaacttag gatatgcctt acatatcgta       840
     aaaggaaatg gcgcatttga ttatgccatg gatattaatc gacggttact ggagtaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page