(data stored in ACNUC1104 zone)

EMBL: FN667742.PE588

FN667742.PE588       Location/Qualifiers
FT   CDS_pept        517725..518600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0113"
FT                   /locus_tag="XNC1_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88681"
FT                   /db_xref="GOA:D3VJC5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88681.1"
FT                   /translation="MKDFEINLFDAHIHTEFEGTPDHFSGIIASLDFFKESINGINFVG
FT                   ALSDSATPSQNHGDLREHGIYHCAVIRDLNYDIDIIEKKIISGRVYAIKINVGFIHRYA
FT                   SDTHFQPLYALAEQLSVPVMFHSGDPGWPHAKVKYADPISFDEIAVDYPGVNFVLVHAG
FT                   NPWFQSAAVVAAKNNNIFLEGSSLIDGDIKVCSDERARRLISNPLSWIIDYLGSSEKLI
FT                   FGSGWPMVDLKSYIDIFRQGIPEQAWNNVFCDNALRLYGFVMEKESNGQLICVPKLQRK
FT                   NSNNVHYSSK"
     atgaaagact ttgaaattaa tttatttgat gctcatatcc atactgagtt cgaaggtaca        60
     ccagaccatt ttagtggaat aatagcaagc ttggattttt ttaaagaatc aattaatggg       120
     atcaattttg ttggggcatt atcggattct gcaacacctt cacaaaatca tggcgatttg       180
     cgtgagcatg gaatttacca ttgtgctgtt ataagagatt tgaattatga tattgatata       240
     attgaaaaaa aaattatttc tggtagggtt tacgcaataa aaattaatgt tggatttata       300
     catcggtatg catctgatac gcatttccaa ccactttatg ctcttgctga acagttaagt       360
     gtaccagtaa tgtttcatag tggtgatccg ggttggccgc atgctaaggt aaaatatgct       420
     gatcctattt cttttgatga aattgcggtt gattatcccg gtgttaattt tgttctggtg       480
     catgctggaa acccctggtt tcagagtgca gcagttgttg ccgctaaaaa taataatata       540
     tttctggaag gttcatcatt gattgatggt gatataaaag tatgttctga cgaacgtgca       600
     agaagattaa tctcaaatcc attatcttgg ataatagatt atcttggttc ttcagaaaaa       660
     ttaatttttg gttctggttg gcctatggta gatttaaaat cttatatcga tattttccgc       720
     caggggattc ctgaacaagc ctggaacaat gttttttgtg ataatgccct aagattatac       780
     ggatttgtaa tggaaaaaga atctaatggg cagttaatct gtgtaccaaa attacaacgg       840
     aaaaattcaa ataatgtcca ttattcaagt aaatga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page