(data stored in ACNUC1104 zone)

EMBL: FN667742.PE590

FN667742.PE590       Location/Qualifiers
FT   CDS_pept        519560..520366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0113"
FT                   /locus_tag="XNC1_0609"
FT                   /product="putative ABC-2 type transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88683"
FT                   /db_xref="GOA:D3VJC7"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88683.1"
FT                   /translation="MLKHVKRSLLLWQVLIGQSFSRVIAYRAQSIIWLLGGIMPIAMMF
FT                   VWLGLAKEGEVGSYTASDFAVYFLSIYLVRQLTAIWVMRRLDSDIRRGELSMLLLRPVS
FT                   PLYSYVSDHTGEMMVRGPIISLVFISGILLTGNFHRLDIGNLLTFIPALALAWIIIFHL
FT                   YYCLGLLAFWINNSMAFDPLLWALYTILGGVLIPLDLYPESIASWLKLLPFSSALDFPV
FT                   QIILGKLNNFLLLIGFGVQLFWVVFLTLIRILLWNAGLRRYSASGV"
     atgttgaagc atgttaagag aagcctgttg ttatggcagg tacttattgg tcagtctttt        60
     tcaagagtca ttgcatatcg cgctcaatca attatttggt tattaggtgg tatcatgcct       120
     atagccatga tgtttgtttg gttaggattg gcaaaagaag gggaagtcgg cagttacact       180
     gcaagtgatt ttgcagttta ttttctttca atctatttag ttcgccagtt aacagcaatt       240
     tgggttatgc ggcgtttaga tagtgacatc agaaggggag aattatcgat gctgttgcta       300
     cggccagttt ctcctctcta tagctatgtc tctgatcata ctggagaaat gatggttaga       360
     gggccaatta tttcactggt ttttatatca ggtattttac tgacaggtaa ttttcatcgt       420
     ttagatattg gaaacttact gacttttatc ccagctcttg ctttggcgtg gattattata       480
     ttccatcttt attattgtct cggattgttg gcattttgga tcaataactc aatggcgttc       540
     gatccattgc tttgggcact ttataccatt ttaggcgggg tgttaattcc acttgatttg       600
     tacccagaaa gtatagcttc ttggttgaag ttattgcctt tttcttcagc attagacttt       660
     ccggttcaga taatattggg aaaattgaat aacttccttc tattgattgg gtttggagta       720
     cagctgtttt gggttgtttt tctgacactt attagaatat tattatggaa tgcaggacta       780
     agaagatatt cagcatctgg agtttaa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page