(data stored in ACNUC1104 zone)

EMBL: FN667742.PE591

FN667742.PE591       Location/Qualifiers
FT   CDS_pept        520370..521152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0113"
FT                   /locus_tag="XNC1_0610"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88684"
FT                   /db_xref="GOA:D3VJC8"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88684.1"
FT                   /translation="MRYILLFLVLLRHSFLLEFEFRFNAIVNLINSSLSCLLALLVLTG
FT                   FFGQVSQVGGWTYYQMVALLGVTLIIESFIDSWLFPSVHSLSEYIRRGDLDLIIIRPVD
FT                   TQFFISFHRFNIWDGANFIVGYVVVLLAMYQQDALTIWNFLQFNIALLLGACVFYSLFM
FT                   CSNLIAFWFTKVSDVWVICYSLMDIGRFPVSAYPGALRFLLSFLLPVFFVSNVPAQAAL
FT                   GILSMKTLLLAFLYAMGAIILTRLFWLKAISKYSSASS"
     atgagataca ttttattatt tttagtctta ttaagacatt cttttttgtt ggagtttgaa        60
     tttcgattta atgcgatagt aaatttaatc aactctagtc tttcttgttt actagcgtta       120
     ttagtattga caggtttttt tggacaggta tctcaggttg gtggctggac atactatcag       180
     atggtcgctt tattaggggt aactctcatt attgagtctt ttattgatag ttggttattt       240
     ccaagtgtcc attcgctctc tgagtatatc aggcgtgggg atttggattt aattattatt       300
     cgtcccgttg atacacaatt ttttattagt tttcatcgtt ttaatatatg ggatggagct       360
     aactttattg ttggttatgt ggttgtttta ttagcaatgt atcaacagga tgcattgact       420
     atttggaact ttttacaatt taacattgct ctgttattag gtgcctgtgt tttctattcc       480
     ctttttatgt gttcaaattt gattgctttt tggttcacga aagtgtcaga tgtgtgggtt       540
     atttgttatt cgctaatgga tattggccgt tttccagtta gtgcatatcc gggtgcttta       600
     cgttttttat taagtttttt attgcccgtt ttctttgtca gcaatgtacc tgctcaggcg       660
     gcattaggaa tattaagtat gaaaactcta ttgttggctt ttttatatgc catgggggcg       720
     attatattaa ctcgtttatt ctggttgaaa gcgatttcaa aatatagtag tgcaagtagt       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page