(data stored in ACNUC1104 zone)

EMBL: FN667742.PE6

FN667742.PE6         Location/Qualifiers
FT   CDS_pept        complement(7218..7487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88099"
FT                   /db_xref="GOA:D3VG09"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88099.1"
FT                   /translation="MSTLVMSAHNAIKALKESGLNETQAEKIVEIIADLQNTSAVTKED
FT                   LKQAEMNLRTDLTSIKNDMDWLKKLIVTVGIAVVIAAIKYIFVG"
     atgtcaactc tggtcatgag cgcacataat gccattaagg ccctgaaaga atcgggcctg        60
     aatgaaacgc aagcagaaaa aattgttgaa attattgcag acttacaaaa taccagcgca       120
     gtgacaaaag aggatttaaa gcaagctgaa atgaatttaa ggactgattt aacctcaatt       180
     aaaaacgata tggattggct gaaaaaatta attgtcaccg tcggaattgc cgttgtcatt       240
     gctgccataa aatacatttt tgtaggttaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page