(data stored in ACNUC1104 zone)

EMBL: FN667742.PE601

FN667742.PE601       Location/Qualifiers
FT   CDS_pept        531296..531886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0115"
FT                   /locus_tag="XNC1_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88694"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88694.1"
FT                   /translation="MLRNPIHLRLEKLESWQHLTFMASLCERMYPNYQVFCRQSGFTDP
FT                   AQYRRILDIVWEILVVKDAKVNFDNQLEKLEAIIPSSESYDIYGVYPAIDACIALGEVI
FT                   HSRLSGSTLKHAIAVSEISIRTVAMLEMTQAGREMTEDELKVLPAIEEEWDIQWEIYRL
FT                   LANCEERDIELIKGLKADLREMGVSNIGINLEQ"
     atgttaagaa acccgatcca cctgaggttg gagaagctcg aaagttggca acatttgact        60
     tttatggcta gtctatgtga gcggatgtac ccaaattatc aggtgttttg tcgccagagt       120
     gggtttacag accctgcaca gtaccgccgc attttggata ttgtatggga aatattggtc       180
     gtcaaagatg cgaaagtgaa ttttgataat cagctggaaa aactggaagc cattatccca       240
     tcatcagaaa gttatgatat ttatggtgtg tacccagcga ttgatgcgtg tattgcactg       300
     ggtgaagtca ttcattctcg tctgagtggc tcgacgttaa aacatgcaat agccgtcagt       360
     gaaatatcca tccgtactgt tgctatgctg gaaatgacgc aggctggtcg ggaaatgacc       420
     gaggatgaat taaaagtatt acctgccatt gaagaagagt gggatattca atgggagatt       480
     taccgtttat tggctaattg cgaagaacgg gacatcgaat taattaaagg attaaaggct       540
     gatctccgtg agatgggggt tagcaatatc ggcataaatt tagagcaata a                591
//

If you have problems or comments...

PBIL Back to PBIL home page