(data stored in ACNUC1104 zone)

EMBL: FN667742.PE603

FN667742.PE603       Location/Qualifiers
FT   CDS_pept        532362..533063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0116"
FT                   /locus_tag="XNC1_0622"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88696"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88696.1"
FT                   /translation="MRGGYSKPLLLILQGLLALGFISLLSACSIQPKSSPFSASGFVAD
FT                   NGIIRLWRLNDQNSKPQVIMSVYSPYHNKNTTVTFYEYRHGNLWQIRRNVLGHSLNDKM
FT                   PIAETLRIDQNNVVIFKLRQLKDRNELLSDNDVKSLQLDAKQILETSDALIAKNIMLLQ
FT                   GHWQNSRVTTCAGKQLFIEFNPDAQRWLKERQSNSSGPLTIAWLDSSEGKQLLLVANDD
FT                   FCRWEPTKDKL"
     atgagagggg ggtattcaaa accccttttg ttgattctac aggggctgct agcattaggg        60
     ttcatctctt tgctcagcgc ctgttcgatt caacctaagt catcaccttt cagcgcaagt       120
     ggctttgtgg ctgataacgg tattattcgt ttatggcgtt tgaatgatca aaatagtaag       180
     cctcaggtta ttatgagtgt ttacagcccc taccataata aaaataccac agtgactttc       240
     tacgaatatc gtcatggtaa tttgtggcaa attcgccgta atgtccttgg tcattccctg       300
     aatgataaaa tgccaattgc ggaaacatta cgtattgatc aaaataacgt ggttattttt       360
     aaattacggc aattaaaaga tcgtaatgaa ttactttccg acaatgatgt aaaaagtttg       420
     cagcttgatg ctaaacagat actggaaacc agtgatgcct taattgcaaa aaatattatg       480
     ttattacagg ggcattggca gaatagtcgg gtgactactt gtgcaggaaa acaattgttc       540
     attgaattta atcctgatgc tcagagatgg cttaaagaaa ggcaaagtaa tagttctggc       600
     ccattaacaa ttgcctggct ggattcgtcg gaaggaaaac agttattgtt ggttgctaat       660
     gatgattttt gtcgctggga gccgacgaaa gataagctgt aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page