(data stored in ACNUC1104 zone)

EMBL: FN667742.PE606

FN667742.PE606       Location/Qualifiers
FT   CDS_pept        536225..536506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0625"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88699"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88699.1"
FT                   /translation="MQQMIIFSKKNYCQRRKTPYNAPPLTDAELRHAAEDSRRDSENKR
FT                   LTPEAKSVRYAASQPGRRFPVAPLFNKLIRQSVWALTRHYRTPKGEKD"
     atgcagcaaa tgataatttt ttcgaaaaaa aactattgtc agcggcgtaa aactccctat        60
     aatgcgccac cactgaccga cgctgagctg agacacgccg ccgaggacag tcggagagac       120
     agcgaaaata aacgcttgac tccggaggcg aaaagcgtaa gatacgcagc ctcgcaaccc       180
     ggaagacgct tcccggttgc cccgctcttt aacaagttaa tcagacaatc tgtgtgggca       240
     ctcacaagac actatcgcac gccgaaaggc gaaaaagatt aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page