(data stored in ACNUC1104 zone)

EMBL: FN667742.PE61

FN667742.PE61        Location/Qualifiers
FT   CDS_pept        complement(67934..68482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0012"
FT                   /locus_tag="XNC1_0066"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88154"
FT                   /db_xref="GOA:D3VG64"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="InterPro:IPR016778"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88154.1"
FT                   /translation="MYQVNFLPWRQKRLKRRCQKWGLMLCLQIALWSAVLALISTQQTR
FT                   QIAQHRDKLTEIKHQLALFQHTIRETDQAVQQHEQLTQLLRKKQVFMEQNQRYLQLFRQ
FT                   LPHLLPQKSWLTAFSDANGQLIFTAHSQDYAEISDLLDNLTEDQALINVQLKKMTTGDD
FT                   QIKVFTIDADWLMGEAHEK"
     atgtaccaag tcaatttttt accctggcga caaaaaagac tgaagcgtcg atgccaaaag        60
     tggggattga tgctctgttt acaaattgca ttatggagcg ctgtattagc gttaatttct       120
     acgcaacaaa cccgccagat tgcacaacat cgcgataaat taacagaaat taagcaccaa       180
     ttagcgctat ttcaacacac tatccgagaa acggatcaag cggtacaaca acatgagcaa       240
     ctgactcaat tattacggaa aaaacaggta ttcatggaac agaatcaacg ttatttacag       300
     ttatttcgtc aacttcccca tctgttaccg caaaaaagct ggctgacagc atttagcgat       360
     gctaacgggc aactcatttt taccgcccat agccaggact atgccgaaat ctccgattta       420
     ctggataacc tgactgaaga tcaggctctc atcaatgtcc agttaaaaaa aatgaccaca       480
     ggcgacgatc aaatcaaagt ctttactatt gatgccgact ggttaatggg agaagcccat       540
     gaaaagtaa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page