(data stored in ACNUC1104 zone)

EMBL: FN667742.PE610

FN667742.PE610       Location/Qualifiers
FT   CDS_pept        543669..545267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0118"
FT                   /locus_tag="XNC1_0632"
FT                   /product="putative allophanate hydrolase subunit 1 and 2"
FT                   /EC_number="3.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0632"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88703"
FT                   /db_xref="GOA:D3VJE7"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88703.1"
FT                   /translation="MRFLPINFNTIMVDLKGLSATLALLDSLNMAPIPGIEEIIPAART
FT                   LMIRFRPIKISAQQLAEEICHRDLQERSYAAGKKIEIPVHYNGEDLAIVAEILGMTIQE
FT                   VIRQHTENEHTVAFTGFAPGFAYMVSDTSSWDIPRKKIPRTYIPAGAVALAGEFSSVYP
FT                   QASPGGWQIIGITTERMWDLSRLSPALLQPGYRVNFRNAGRLRTTVGLPEVPSRNTASC
FT                   PGTSCHLEILSVGLQTLFQDLGRIGQSGLGISESGALDKSALRGANRIVGNVSDQACLE
FT                   IAQGGFKAIAHGQIVIAITGAPCPIEIKTPEGETLYVNTYQPIDLNDGDEISLGTPAAG
FT                   MRSYLAVRGGFAVPAILSSHSFDTLSNIGPSPLNVRDKLAVREISHCAAVSFSETPAFV
FT                   MPNKEDVVILDIILGPRTDWFTQEALNLLSQQIWQVTPQSNRIGLRLNGKHSLSRTKQQ
FT                   ELPSEGTCTGAIQIPASGQPVLFLADHPLTGGYPVIASVADYHLDLAGQVPINARIRFN
FT                   PISQFQEIQGSKDFS"
     ttgcgttttt tacccattaa tttcaatact ataatggttg atctgaaggg attgtctgca        60
     actttggcgc tgcttgattc actgaatatg gcgccaattc ccgggattga agagattatt       120
     cctgcggcca gaacgctgat gatccgtttt cgaccgataa aaatatcagc ccagcaattg       180
     gctgaagaaa tctgtcaccg tgatttgcag gaacgtagtt atgccgcagg aaaaaagatt       240
     gaaattccag tgcattataa cggtgaagat ctggcaatag tcgctgaaat attggggatg       300
     acaatccaag aggttattcg ccaacataca gaaaatgaac acacagtcgc ttttactggt       360
     tttgctcctg gttttgccta tatggtgtca gatacctctt cgtgggatat tcctcgcaag       420
     aaaataccaa gaacatatat tcctgccggc gcggttgcac tggcagggga attcagcagt       480
     gtttatccac aggcgagtcc tggaggatgg cagattatcg gtattacaac cgaacgtatg       540
     tgggatcttt cccgactctc tcccgcttta ttgcaaccgg gttaccgcgt taatttccgg       600
     aatgccgggc ggctccgcac aacagtaggt ttgcctgagg taccttccag gaatactgct       660
     tcttgccccg gaacttcctg tcatttggaa atcttatccg tgggattgca gaccctgttt       720
     caagatttgg ggcgaatcgg gcaatcagga ttggggatct ccgaatcggg agcattggat       780
     aaaagcgctt tgcgtggtgc aaaccgcatt gttggcaatg tttctgacca agcttgtctg       840
     gaaatagcac agggcgggtt caaggctatt gcacatggac aaatagtgat tgcgatcacg       900
     ggagcaccat gcccgataga gattaagact ccagagggtg aaacgcttta tgtgaacact       960
     taccaaccta ttgatctaaa cgacggcgat gaaatttcgt tgggaactcc agccgctggt      1020
     atgcgttctt atctggctgt gagaggtggt tttgctgttc cggccatttt atccagccac      1080
     tcatttgata cactttctaa tatcgggcca tcaccgttaa atgtgcggga taaactggcc      1140
     gtcagagaaa tatcccactg cgcagcggta tctttttctg aaacgccggc ttttgttatg      1200
     ccaaataaag aggatgttgt gatattggat atcattcttg gtccccgcac agattggttc      1260
     actcaggaag cactcaattt attaagccag cagatttggc aggtgacccc gcaatctaac      1320
     cgaattggtc tgcgacttaa tggtaagcac tcactatcac gaactaaaca gcaagaacta      1380
     cccagtgaag gcacttgcac tggagcgatt caaattcctg ccagtggtca gcctgtacta      1440
     tttttagctg atcatccact tacaggaggc tatccggtca tcgcttccgt tgcagactat      1500
     catcttgatc ttgccggtca ggttcctatc aacgccagaa ttcgttttaa ccccatcagc      1560
     caattccaag aaatccaagg gagcaaagat ttttcatga                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page