(data stored in ACNUC1104 zone)

EMBL: FN667742.PE62

FN667742.PE62        Location/Qualifiers
FT   CDS_pept        complement(68482..69345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0012"
FT                   /locus_tag="XNC1_0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88155"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88155.1"
FT                   /translation="MYPSKWYIGLDIQDHDIRALAAIKRRDGWQLRHCWQYRLSGEIIS
FT                   GGRLQNPEKLRHILIQWRQILPKNISLRLALPVQQTLQRQFTLPDHASLQEPELGWFVY
FT                   ASAEKQFPVSDLALDYRIHDQQVCISAIRQKDLNLWLKLFADINLYPDAIDIAPCALRY
FT                   AARLSGIPDNSWLVHKRTMDWLWVSPVNPAFGYGLIASQAYPHLAQVIKQLPITPETGS
FT                   NAIYCSSEERDEEEQIISAKTAAELTESIHHWQLLSAFRHYHPPLPEQTNTFIIAAGLA
FT                   LRPDDK"
     atgtatccat ctaaatggta tatcggactg gatatccaag atcatgacat ccgcgcactc        60
     gcagccatta aacgtcgtga tggctggcaa ctgcgacatt gctggcaata tcgcttatcg       120
     ggcgaaatta tttcaggagg acggctgcaa aatcctgaaa aattacgcca cattttaatc       180
     caatggcgac aaatattacc caaaaatatt agcttaagat tggcactccc tgttcagcaa       240
     acattacaac gacagttcac cttgcctgac catgcgtcac tgcaagagcc tgaacttggc       300
     tggtttgtat acgccagtgc cgaaaaacaa ttccccgtca gtgatctggc attagactat       360
     cgcattcatg atcagcaagt ttgcatcagc gctatccgcc aaaaagatct caatctctgg       420
     ctcaagttat ttgcggatat caatctgtac cctgatgcca ttgatattgc cccttgtgcg       480
     ttgcgttatg cagccaggct ctcaggtatt cctgataaca gttggctggt tcacaaacgc       540
     acaatggact ggctatgggt ttctcccgtc aaccctgctt ttggctatgg gctgatagca       600
     tcacaagcct atcctcattt ggctcaggtc attaagcagt tacccatcac acccgaaaca       660
     ggaagtaacg cgatttattg cagcagtgaa gagcgtgatg aagaagaaca aataatttca       720
     gcaaaaacgg cagcagaact cacagaatcc attcatcatt ggcagctttt atcagcattt       780
     cgccattatc atcctccgtt accagaacaa acaaatacgt tcattattgc ggcggggctg       840
     gctctccgac cggatgataa atga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page