(data stored in ACNUC1104 zone)

EMBL: FN667742.PE622

FN667742.PE622       Location/Qualifiers
FT   CDS_pept        557183..557353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0644"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88715"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88715.1"
FT                   /translation="MSHLNAQSIEMEGDGISYFHGRNRGVLLVFSVLHFMIDEGWNSVG
FT                   FLGLKIGRVKK"
     ctgagtcatc tgaatgccca atctatagaa atggaaggag acggaatcag ttattttcat        60
     ggtagaaaca ggggtgtttt attggttttt tcggttttac acttcatgat tgatgaagga       120
     tggaatagcg tcggttttct cggcctgaaa ataggccgtg taaaaaaata g                171
//

If you have problems or comments...

PBIL Back to PBIL home page