(data stored in ACNUC1104 zone)

EMBL: FN667742.PE624

FN667742.PE624       Location/Qualifiers
FT   CDS_pept        559887..563051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0120"
FT                   /locus_tag="XNC1_0646"
FT                   /product="Putative non-ribosomal peptide synthetase
FT                   (fragment)"
FT                   /EC_number="5.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0646"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88717"
FT                   /db_xref="GOA:D3VJG1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88717.1"
FT                   /translation="MNTHTHKAILHTAFTGQKLSPATDMKMNSNISQMTAELDPWFKNV
FT                   PSRLAELADVLPNDIAVSDPYEMLTFGELHLRIENAAHLLRHYGVKMGSNVAIAAQRGI
FT                   AWFVTMQAIWRLGAVYIPLNTMMPEKRLNDILASLPESILVSDNTVSSGLKASTLIPMD
FT                   KVLGKINKTSGAETVEDIEIPELGDHPAYVMFTSGSTGLPKSVQVQHENLAACLCAFGK
FT                   LLSISQRDHMLALTTFSFDISVLELLLTVVHGGSIYITSIDTQRDAMALSETLSNSQFT
FT                   YAQATPVTWSMALNAGWKPRPEMSMLCGGEALSQDLADQLTATGGILWNLYGPTETTIW
FT                   STAFRMEKGDKVQLGGPIPGTTITIVDKYLRPVPKGTVGEILIGGMGVTAGYRNNPTET
FT                   AKRYVPDIAQKGKRAYLTGDMARMLEEGSFIYMGRQDDQVKVRGYRIELGEIEIALRKQ
FT                   DGVQDAIIRVAGSGDLAKIQAFVLFHQNMIVAEDWVSETQLALREVLHEAWIPTEYYRI
FT                   PYIPLTSSGKRDKKRLEEVAERLNASYDAVQPQTETEKRVYAIWRDLLATDVFGITDDF
FT                   FQIGGHSILVARMVENIEKAFSLRVPISGIYIEPTVARIAAILDEMTAERQMNPARIAG
FT                   IYHSEALIRQHAETLRNDVYLKEGVRPDGLPHANWYQPDTVLLTGATGYLGLHLLEQLL
FT                   KQTSARIICLCRASDEEHARDRIRAGFTNYQINVGHGLDRVDFVIGDLGQPRFGLLPET
FT                   WAQLAEHVDVIYHNGALVNFTYPYSALKSINVDGTRTALELACTSRLKHFHYVSSVNAL
FT                   FATESPRPYMEDDRAMSESVRDPSGYSGSKWVSEGIINIARKRGVPVSIYRPGLILGHT
FT                   RTGAAQGNDYLIASLKGYLAMGFYPDHALLLDITPVDYVAASLVHISRKPESNGKFFNL
FT                   FNPEQVSIRQFFDWVQEFGYILNPVPFNEGKEKILALDDTHPLYPLIPLIRDMTERPYR
FT                   ALDPAYIDEIHPELELKNTLSGLAGSNIRCPVITAAYVHQVLRYLIGTGFLPALLPESF
FT                   KQEAVA"
     atgaatactc acacacacaa ggcaatatta cacacagcat ttactgggca aaaactctct        60
     cctgctactg atatgaaaat gaatagtaat atcagtcaaa tgacagcaga actagatcct       120
     tggtttaaaa atgtcccctc tcgcttggct gagctagcag atgtgttacc taatgacatc       180
     gccgtttctg atccctatga aatgctgaca tttggtgaat tacacttgcg gattgagaat       240
     gccgcacatc tcttgcgtca ctatggcgtt aaaatgggca gcaatgttgc cattgcggct       300
     cagcggggga ttgcatggtt tgttactatg caggcaattt ggcggcttgg ggcggtgtat       360
     atccccctga acaccatgat gcctgaaaaa cgcttgaatg atatccttgc cagtctgccg       420
     gaaagtattc tggtatctga taatacggtg tcttcgggac ttaaggcatc aacattaatc       480
     ccgatggata aggtcttggg taagatcaat aagacatccg gcgctgaaac tgtagaggat       540
     attgagatcc ctgagttggg cgatcatcct gcttatgtca tgtttacctc tggctctacg       600
     ggcctgccaa aatcagtaca ggtgcagcat gagaatctgg ctgcttgcct gtgtgcgttt       660
     ggcaaattac tgtcaatcag tcagcgtgac catatgctgg cactgacaac attctctttt       720
     gatatctcag tcctggaatt gttgctgacc gtcgttcatg gtggcagtat ctacatcact       780
     tcaattgaca cccaacgtga tgcgatggca ttgtccgaaa cattgtcgaa ttcacaattt       840
     acctatgctc aggcaacacc tgtaacttgg tcaatggcgt tgaacgcagg ttggaaacct       900
     cgtcctgaaa tgagcatgct ttgcggtggc gaagcgctgt cgcaagatct ggcagaccaa       960
     ttaaccgcga caggcgggat cttgtggaac ctctatggcc caacggaaac aaccatctgg      1020
     tcaacggcat tccgcatgga aaaaggggat aaagtccagt tgggcggccc aattcccggc      1080
     actacgatta ctattgtaga taagtactta cgcccggttc ctaagggaac tgtaggggaa      1140
     attctcatcg gtggaatggg ggtgacggca ggttatcgta ataatccgac cgaaactgcg      1200
     aaaagatatg ttcctgatat agcacaaaaa ggtaaaagag cctatctgac gggtgatatg      1260
     gcacgcatgc tggaagaagg ttctttcatt tatatgggca ggcaggatga tcaggtgaaa      1320
     gtgcgtgggt atcggattga gctgggtgaa atagaaattg cattaagaaa acaagatggt      1380
     gtgcaggatg cgatcatccg ggtagcaggt agtggtgatt tggctaagat ccaagcgttt      1440
     gttctgttcc atcagaatat gattgtagca gaggattggg tgagcgagac acaattagca      1500
     ctcagggaag tgctgcatga agcctggata ccaactgaat attaccgtat tccttatatt      1560
     ccgctgacaa gcagtggtaa aagagataaa aagcggttgg aagaagtggc ggaacgattg      1620
     aatgccagct acgacgcagt acagccacaa acagaaacag aaaaacgcgt ttatgcgatt      1680
     tggcgtgatt tactggcaac ggacgtgttt gggatcactg atgatttctt ccagataggg      1740
     ggacattcca ttctggttgc ccgcatggta gagaacattg aaaaggcatt ttcattacgg      1800
     gttccgattt ctggtatcta tatagaaccg acggttgcca gaatcgcggc cattctggat      1860
     gaaatgacag ccgaacgtca gatgaaccct gcccgtatcg cgggaatcta tcacagcgaa      1920
     gcgttgattc gccaacatgc ggaaaccctc agaaatgatg tctacctgaa agaaggggtt      1980
     cgtcctgatg gattgcctca tgccaattgg taccagccgg atactgtctt gctgaccggc      2040
     gctaccgggt atcttggact gcatttgctg gaacaactgt tgaaacagac ctcagccaga      2100
     attatctgtt tgtgccgtgc atctgatgaa gaacatgccc gtgacaggat cagagccgga      2160
     ttcaccaatt accagattaa tgttggtcat ggtcttgacc gggtggactt tgtgatcggt      2220
     gatttggggc aaccacgttt tggcttgctg ccggaaacat gggcgcagct tgcagaacat      2280
     gttgacgtta tttatcacaa tggcgcgttg gttaacttca cctaccccta cagtgcatta      2340
     aagagtatca acgttgatgg taccagaaca gcacttgaac tggcctgtac ctcacgcttg      2400
     aaacatttcc actatgtttc ttccgtgaat gcactgtttg ctacagaatc accacgtcct      2460
     tatatggaag atgatcgtgc catgagtgag tcggtgcgtg acccttccgg atattcaggc      2520
     agtaagtggg tatcagaagg gatcatcaat attgcccgca aacgaggcgt tcctgtcagt      2580
     atttatcgtc cgggcctgat tctggggcat acccgtacag gggcggcaca gggtaatgat      2640
     tacctgattg cctcattgaa agggtatctg gcaatgggct tttatccgga tcatgcttta      2700
     ctgcttgata tcacaccggt tgattatgtg gctgcatcgt tggtgcatat ctccaggaaa      2760
     ccggaatcaa atggaaaatt cttcaacttg ttcaacccag aacaagtttc catccggcaa      2820
     ttcttcgact gggtgcagga gtttggttat atcctcaatc ctgtgccatt taatgagggg      2880
     aaagagaaaa tcctggcatt agatgatact caccctctgt atccactgat cccgctgatc      2940
     agggatatga cagaaaggcc ttaccgggca ttggatccgg cttatatcga cgaaattcat      3000
     cctgaattgg agttgaaaaa tacattgtca ggattggctg gaagcaacat tcgttgtccg      3060
     gtaattacgg cggcatatgt tcatcaggta ttgcgttatc tgattggcac ggggttcttg      3120
     ccggctctcc tgccagagag cttcaaacag gaggcggtag catga                      3165
//

If you have problems or comments...

PBIL Back to PBIL home page