(data stored in ACNUC1104 zone)

EMBL: FN667742.PE625

FN667742.PE625       Location/Qualifiers
FT   CDS_pept        563048..563230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0120"
FT                   /locus_tag="XNC1_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0647"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88718"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88718.1"
FT                   /translation="MKQLTGNDAMNWMVVLNGKKQYSVWPTEYDIPVGWMATGRTGSKD
FT                   DCLNHIAAIWPEPTK"
     atgaaacagt taaccggaaa cgatgccatg aattggatgg ttgtgctcaa tggtaaaaag        60
     cagtattcgg tctggccgac ggaatatgac attccggtgg ggtggatggc aacgggcaga       120
     acgggatcta aagatgattg cctgaatcat attgctgcca tttggccgga acccacaaaa       180
     tag                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page