(data stored in ACNUC1104 zone)

EMBL: FN667742.PE634

FN667742.PE634       Location/Qualifiers
FT   CDS_pept        569626..569982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XNC1_0656"
FT                   /product="small ubiquitous RNA-binding protein required for
FT                   normal growth, cytoplasmic (modular protein)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0656"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88727"
FT                   /db_xref="GOA:D3VJH1"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88727.1"
FT                   /translation="MTGVSERSQQRGSLKDEVYNIIHRHRLFEPTEIVMSDIFSHPDKM
FT                   LDTSGLRCPEPVMMVRKTIRHMAVGQTLLIIADDPATTRDIPGFCRFMEHVLIAQETAQ
FT                   TPYRYLLRKNENMG"
     gtgaccgggg tgagcgaacg cagccaacaa agaggcagtt tgaaagacga agtgtataat        60
     ataattcacc gccatagatt gtttgaacct acagagattg ttatgtccga tattttttcc       120
     catccagaca aaatgcttga tacctcggga ttacgctgcc cagaacccgt gatgatggtc       180
     cgtaagacaa ttcgccatat ggctgttggt cagacgctgt taattattgc agatgatccg       240
     gcgaccaccc gtgacatccc gggattttgc cgttttatgg agcatgtgtt gattgcgcag       300
     gaaacagcgc aaacacctta tcggtatctg ctgagaaaga acgaaaatat gggttga          357
//

If you have problems or comments...

PBIL Back to PBIL home page